PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC10G16590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 382aa    MW: 39301.4 Da    PI: 7.7602
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC10G16590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.86.4e-18275310136
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkglk 36 
                      C++C + kTp+WR gp g+ktLCnaCG+++++ +l+
  OPUNC10G16590.1 275 CTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLM 310
                      ********************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.253269305IPR000679Zinc finger, GATA-type
SMARTSM004012.3E-16269319IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.05E-13273333No hitNo description
Gene3DG3DSA:3.30.50.102.5E-13273307IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.79E-13274321No hitNo description
PfamPF003201.3E-15275310IPR000679Zinc finger, GATA-type
PROSITE patternPS003440275300IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MASEWEMAMG AVDLGMGMST YHNASGGIAA APMMGHHGGG GGGYSAGHHH HHYYGMPAAA  60
MGDAMRVDDL LDLSNTPGAH DFFPASAAAA AGDNGHHHHH HHHIGGMGEP SGATPSATSS  120
DHQTSMLSFA DDFYIPTEEA AELEWLSKFV DDSYSDMPNY QSSAHAAMAA AAAASAANNG  180
GGSSAGQDSC LTAAPGRGAR SKRSRATAAA AAAWHSLVPR PPSQSSPSSS CSSSDFPSSN  240
KPSAARPNGS SGSRGKKSPS PTGAEVGMEA GVRRCTHCAS EKTPQWRTGP LGPKTLCNAC  300
GVRFKSGRLM PEYRPAASPT FVLTQHSNSH RKVMELRRQK ELLIIRGSHR DAAAAAAAAA  360
AAAGSAAATG RPELMFRDYG VC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0693000.0AC069300.7 Oryza sativa chromosome 10 BAC OSJNBa0010C11 genomic sequence, complete sequence.
GenBankAK2422920.0AK242292.1 Oryza sativa Japonica Group cDNA, clone: J075191F19, full insert sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankCP0126180.0CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613303.11e-163PREDICTED: GATA transcription factor 2
SwissprotO497414e-61GATA2_ARATH; GATA transcription factor 2
TrEMBLA0A0E0MAM00.0A0A0E0MAM0_ORYPU; Uncharacterized protein
STRINGORGLA10G0133700.11e-165(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.11e-45GATA transcription factor 2